PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00021819-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family NF-YB
Protein Properties Length: 150aa    MW: 16874.9 Da    PI: 6.5285
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00021819-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.46.7e-5631122293
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       reqdrflPian+srimkk++Panaki+kdak+tvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyvepl++yl+kyre 
  PSME_00021819-RA  31 REQDRFLPIANISRIMKKAVPANAKIAKDAKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMGTLGFEDYVEPLRLYLQKYREK 122
                       89****************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.5E-5325129IPR009072Histone-fold
SuperFamilySSF471132.79E-3933129IPR009072Histone-fold
PfamPF008082.8E-2836100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.9E-226482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.9E-2283101No hitNo description
PRINTSPR006156.9E-22102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MADLASSATS QESPPSEDTN NNSHNQGSNA REQDRFLPIA NISRIMKKAV PANAKIAKDA  60
KDTVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM GTLGFEDYVE PLRLYLQKYR  120
EKIVYSWKKQ QDSDLAHFIG QSRVVQGSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-4831121393NF-YB
4awl_B1e-4831121494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4831121494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1236081e-162BT123608.1 Picea sitchensis clone WS04715_D15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002974019.11e-63CCAAT-box binding factor HAP3
RefseqXP_002983471.11e-63CCAAT-box binding factor HAP3
SwissprotO233105e-63NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD5ABK12e-83D5ABK1_PICSI; Putative uncharacterized protein
STRINGPP1S25_89V6.12e-63(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-64nuclear factor Y, subunit B3