![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00021819-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 150aa MW: 16874.9 Da PI: 6.5285 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.4 | 6.7e-56 | 31 | 122 | 2 | 93 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 reqdrflPian+srimkk++Panaki+kdak+tvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyvepl++yl+kyre PSME_00021819-RA 31 REQDRFLPIANISRIMKKAVPANAKIAKDAKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMGTLGFEDYVEPLRLYLQKYREK 122 89****************************************************************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.5E-53 | 25 | 129 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.79E-39 | 33 | 129 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.8E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.9E-22 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.9E-22 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 6.9E-22 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MADLASSATS QESPPSEDTN NNSHNQGSNA REQDRFLPIA NISRIMKKAV PANAKIAKDA 60 KDTVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM GTLGFEDYVE PLRLYLQKYR 120 EKIVYSWKKQ QDSDLAHFIG QSRVVQGSLS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-48 | 31 | 121 | 3 | 93 | NF-YB |
4awl_B | 1e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT123608 | 1e-162 | BT123608.1 Picea sitchensis clone WS04715_D15 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002974019.1 | 1e-63 | CCAAT-box binding factor HAP3 | ||||
Refseq | XP_002983471.1 | 1e-63 | CCAAT-box binding factor HAP3 | ||||
Swissprot | O23310 | 5e-63 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | D5ABK1 | 2e-83 | D5ABK1_PICSI; Putative uncharacterized protein | ||||
STRING | PP1S25_89V6.1 | 2e-63 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-64 | nuclear factor Y, subunit B3 |